Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | Progesterone Receptor Rabbit mAb |
---|---|
Catalog No. | A19697 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC51400 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 260-330 of human Progesterone Receptor (NP_000917.3). |
---|---|
Sequence | AAAGGVALVPKEDSRFSAPRVALVEQDAPMAPGRSPLATTVMDFIHVPILPLNHALLAARTRQLLEDESYD |
Gene ID | |
Swiss Prot | |
Synonyms | PR; NR3C3; Progesterone Receptor |
Calculated MW | 99kd(CST:90, 118KD) |
Observed MW | 90kDa/118kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | T-47D |
Cellular location | Cytoplasm, Cytoplasm, Mitochondrion outer membrane, Nucleus. |
Customer validation | WB(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A19697? Please let us know so that we can cite the reference in this datasheet.