제품 > 항체 > 단일클론항체(mAb)

Progesterone Receptor Rabbit mAb (A22061)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from T-47D cells, using Progesterone Receptor Rabbit mAb (A22061) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 4s.

Western blot analysis of various lysates using Progesterone Receptor Rabbit mAb (A22061) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

Overview

Product name	Progesterone Receptor Rabbit mAb
Catalog No.	A22061
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC5121-01

Background

This gene encodes a member of the steroid receptor superfamily. The encoded protein mediates the physiological effects of progesterone, which plays a central role in reproductive events associated with the establishment and maintenance of pregnancy. This gene uses two distinct promotors and translation start sites in the first exon to produce several transcript variants, both protein coding and non-protein coding. Two of the isoforms (A and B) are identical except for an additional 165 amino acids found in the N-terminus of isoform B and mediate their own response genes and physiologic effects with little overlap.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 600-700 of human Progesterone Receptor. (P06401).
Sequence	NYLCAGRNDCIVDKIRRKNCPACRLRKCCQAGMVLGGRKFKKFNKVRVVRALDAVALPQPVGVPNESQALSQRFTFSPGQDIQLIPPLINLLMSIEPDVIY
Gene ID
Swiss Prot
Synonyms	PR; NR3C3; Progesterone Receptor
Calculated MW	99kDa
Observed MW	90kDa/118kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	T-47D, Mouse ovary, Mouse pituitary, Rat uterus, Rat pituitary
Cellular location	Cytoplasm, Cytoplasm, Mitochondrion outer membrane, Nucleus
Customer validation	WB(Homo sapiens)