제품 > 항체 > 단일클론항체(mAb)

Proteinase 3/PR3 Rabbit mAb (A19748)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Confocal imaging of paraffin-embedded Human spleen using Proteinase 3/PR3 Rabbit mAb (A19748, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

Overview

Product name	Proteinase 3/PR3 Rabbit mAb
Catalog No.	A19748
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2275

Background

Enables enzyme binding activity; serine-type endopeptidase activity; and signaling receptor binding activity. Involved in several processes, including mature conventional dendritic cell differentiation; membrane protein ectodomain proteolysis; and neutrophil extravasation. Located in azurophil granule lumen; cytosol; and plasma membrane raft. Colocalizes with plasma membrane.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Proteinase 3/PR3 (P24158).
Sequence	MAHRPPSPALASVLLALLLSGAARAAEIVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAAHCLRDIPQRLVNVVLGAHNVRTQEPTQQHF
Gene ID
Swiss Prot
Synonyms	MBN; MBT; NP4; P29; PR3; ACPA; AGP7; NP-4; PR-3; CANCA; C-ANCA; Proteinase 3/PR3
Calculated MW	28kDa
Observed MW	28kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	IF/ICC 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Immunofluorescence
Positive samples	Mouse liver
Cellular location	cytosol, extracellular exosome, extracellular region, extracellular space, plasma membrane, plasma membrane raft.
Customer validation	Other(Saccharomyces cerevisiae)