Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Pumilio 2 Rabbit mAb |
---|---|
Catalog No. | A19783 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC2308 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Pumilio 2 (Q8TB72). |
---|---|
Sequence | MNHDFQALALESRGMGELLPTKKFWEPDDSTKDGQKGIFLGDDEWRETAWGASHHSMSQPIMVQRRSGQGFHGNSEVNAILSPRSESGGLGVSMVEYVLS |
Gene ID | |
Swiss Prot | |
Synonyms | PUMH2; PUML2; Pumilio 2 |
Calculated MW | 114kDa |
Observed MW | 110-125kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | PC-3, Mouse testis |
Cellular location | Cytoplasm, Cytoplasmic stress granule, Cytosol, Nuclear membrane, Perinuclear region of cytoplasm |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.