Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | Purinergic Receptor P2Y6 Rabbit mAb |
---|---|
Catalog No. | A3708 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0831 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 229-328 of human Purinergic Receptor P2Y6 (Q15077). |
---|---|
Sequence | VAQERRGKAARMAVVVAAAFAISFLPFHITKTAYLAVRSTPGVPCTVLEAFAAAYKGTRPFASANSVLDPILFYFTQKKFRRRPHELLQKLTAKWQRQGR |
Gene ID | |
Swiss Prot | |
Synonyms | P2Y6 |
Calculated MW | 36kDa |
Observed MW | 42kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | A549, U-937, U-87MG |
Cellular location | Cell membrane, Multi-pass membrane protein |
Customer validation | WB(Sus scrofa) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A3708? Please let us know so that we can cite the reference in this datasheet.