제품 > 항체 > 다중클론항체(pAb)

Pyruvate carboxylase (PC) Rabbit pAb (A6301)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates, using Pyruvate carboxylase (PC) Rabbit pAb (A6301) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

ABclonal:Immunofluorescence - Pyruvate carboxylase (PC) Rabbit pAb (A6301)

Immunofluorescence analysis of U2OS cells using Pyruvate carboxylase (PC) Rabbit pAb (A6301). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - Pyruvate carboxylase (PC) Rabbit pAb (A6301)

Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg Pyruvate carboxylase (Pyruvate carboxylase (PC)) antibody (A6301). Western blot was performed from the immunoprecipitate using Pyruvate carboxylase (Pyruvate carboxylase (PC)) antibody (A6301) at a dilution of 1:1000.

Overview

Product name	Pyruvate carboxylase (PC) Rabbit pAb
Catalog No.	A6301
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes pyruvate carboxylase, which requires biotin and ATP to catalyse the carboxylation of pyruvate to oxaloacetate. The active enzyme is a homotetramer arranged in a tetrahedron which is located exclusively in the mitochondrial matrix. Pyruvate carboxylase is involved in gluconeogenesis, lipogenesis, insulin secretion and synthesis of the neurotransmitter glutamate. Mutations in this gene have been associated with pyruvate carboxylase deficiency. Alternatively spliced transcript variants with different 5' UTRs, but encoding the same protein, have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 879-1178 of human Pyruvate carboxylase (Pyruvate carboxylase (PC)) (NP_001035806.1).
Sequence	HSMGLGSKFKEVKKAYVEANQMLGDLIKVTPSSKIVGDLAQFMVQNGLSRAEAEAQAEELSFPRSVVEFLQGYIGVPHGGFPEPFRSKVLKDLPRVEGRPGASLPPLDLQALEKELVDRHGEEVTPEDVLSAAMYPDVFAHFKDFTATFGPLDSLNTRLFLQGPKIAEEFEVELERGKTLHIKALAVSDLNRAGQRQVFFELNGQLRSILVKDTQAMKEMHFHPKALKDVKGQIGAPMPGKVIDIKVVAGAKVAKGQPLCVLSAMKMETVVTSPMEGTVRKVHVTKDMTLEGDDLILEIE
Gene ID
Swiss Prot
Synonyms	PCB; Pyruvate carboxylase (PC)
Calculated MW	130kDa
Observed MW	130kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:10 - 1:100 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Immunoprecipitation
Positive samples	HepG2, HeLa
Cellular location	Mitochondrion matrix