제품 > 항체 > 단일클론항체(mAb)

R9AP/RGS9BP Rabbit mAb (A23413)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of extracts from wild type (WT) and 293T cells transfected with R9AP/RGS9BP using R9AP/RGS9BP Rabbit mAb (A23413) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunofluorescence - R9AP/RGS9BP Rabbit mAb (A23413)

Immunofluorescence analysis of R9AP-293F transfected and control 293F cells using R9AP/RGS9BP Rabbit mAb (A23413) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	R9AP/RGS9BP Rabbit mAb
Catalog No.	A23413
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC61024

Background

The protein encoded by this gene functions as a regulator of G protein-coupled receptor signaling in phototransduction. Studies in bovine and mouse show that this gene is expressed only in the retina, and is localized in the rod outer segment membranes. This protein is associated with a heterotetrameric complex, specifically interacting with the regulator of G-protein signaling 9, and appears to function as the membrane anchor for the other largely soluble interacting partners. Mutations in this gene are associated with prolonged electroretinal response suppression (PERRS), also known as bradyopsia.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-107 of human R9AP/RGS9BP. (NP_997274.2).
Sequence	MAREECKALLDGLNKTTACYHHLVLTVGGSADSQNLRQELQKTRQKAQELAVSTCARLTAVLRDRGLAADERAEFERLWVAFSGCLDLLEADMRRALELGAAFPLHA
Gene ID
Swiss Prot
Synonyms	R9AP; RGS9; PERRS; R9AP/RGS9BP
Calculated MW	25kDa
Observed MW	30kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	293T transfected with R9AP/RGS9BP
Cellular location	Membrane ; Single-pass type Ⅳ membrane protein

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

R9AP/RGS9BP Rabbit mAb images

Western blot - R9AP/RGS9BP Rabbit mAb (A23413)

Immunofluorescence - R9AP/RGS9BP Rabbit mAb (A23413)

Immunofluorescence analysis of R9AP-293F transfected and control 293F cells using R9AP/RGS9BP Rabbit mAb (A23413) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

* For research use only. Not for therapeutic or diagnostic purposes.