제품 > 항체 > 다중클론항체(pAb)

RAB11B Rabbit pAb (A15350)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of HeLa cells, using RAB11B antibody (A15350) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Western blot analysis of extracts of various cell lines, using RAB11B antibody (A15350) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

ABclonal:Immunofluorescence - RAB11B Rabbit pAb (A15350)

Immunofluorescence analysis of U2OS cells using RAB11B Rabbit pAb (A15350) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	RAB11B Rabbit pAb
Catalog No.	A15350
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The Ras superfamily of small GTP-binding proteins, which includes the Ras (see MIM 190020), Ral (see MIM 179550), Rho (see MIM 165390), Rap (see MIM 179520), and Rab (see MIM 179508) families, is involved in controlling a diverse set of essential cellular functions. The Rab family, including RAB11B, appears to play a critical role in regulating exocytotic and endocytotic pathways (summary by Zhu et al., 1994 [PubMed 7811277]).

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 100-200 of human RAB11B (NP_004209.2).
Sequence	ENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTEIYRIVSQKQIADRAAHDESPGNNVVDISV
Gene ID
Swiss Prot
Synonyms	H-YPT3; NDAGSCW
Calculated MW	24kDa
Observed MW	24kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	HeLa, Mouse brain, Rat brain
Cellular location	Cytoplasmic side, Cytoplasmic vesicle, Lipid-anchor, Recycling endosome membrane, phagosome membrane, secretory vesicle, synaptic vesicle membrane