Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | RAB14 Rabbit pAb |
---|---|
Catalog No. | A12752 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 39-140 of human RAB14 (NP_057406.2). |
---|---|
Sequence | DCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAK |
Gene ID | |
Swiss Prot | |
Synonyms | FBP; RAB-14 |
Calculated MW | 24kDa |
Observed MW | 24kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | A-549, Neuro-2a |
Cellular location | Cytoplasmic side, Cytoplasmic vesicle, Early endosome membrane, Golgi apparatus, Golgi apparatus membrane, Lipid-anchor, Recycling endosome, phagosome, phagosome membrane, trans-Golgi network membrane |
Customer validation | IF(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A12752? Please let us know so that we can cite the reference in this datasheet.