제품 > 항체 > 다중클론항체(pAb)

RAB1A Rabbit pAb (A17364)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using RAB1A antibody (A17364) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunofluorescence - RAB1A Rabbit pAb (A17364)

Immunofluorescence analysis of L929 cells using RAB1A antibody (A17364) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of U-2 OS cells using RAB1A antibody (A17364) at dilution of 1:100. Blue: DAPI for nuclear staining.

Overview

Product name	RAB1A Rabbit pAb
Catalog No.	A17364
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a member of the Ras superfamily of GTPases. Members of the gene family cycle between inactive GDP-bound and active GTP-bound forms. This small GTPase controls vesicle traffic from the endoplasmic reticulum to the Golgi apparatus. Multiple alternatively spliced transcript variants have been identified for this gene which encode different protein isoforms.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-205 of human RAB1A (NP_004152.1).
Sequence	MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGCC
Gene ID
Swiss Prot
Synonyms	RAB1; YPT1
Calculated MW	23kDa
Observed MW	23kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	HT-29, NIH/3T3, Mouse brain, C6, Rat kidney
Cellular location	Cytoplasm, Early endosome, Endoplasmic reticulum, Golgi apparatus, Melanosome, Membrane, cytosol