Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse
Product name | RAB22A Rabbit pAb |
---|---|
Catalog No. | A15485 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RAB22A (NP_065724.1). |
---|---|
Sequence | MALRELKVCLLGDTGVGKSSIVWRFVEDSFDPNINPTIGASFMTKTVQYQNELHKFLIWDTAGQERFRALAPMYYRGSAAAIIVYDITKEETFSTLKNWV |
Gene ID | |
Swiss Prot | |
Synonyms | RAB22A |
Calculated MW | 22kDa |
Observed MW | 22kDa |
Reactivity | Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Mouse brain, Mouse heart, Mouse kidney |
Cellular location | Cell membrane, Cell projection, Cytoplasmic side, Cytoplasmic vesicle, Early endosome, Endosome membrane, Lipid-anchor, phagosome, phagosome membrane, ruffle |
* For research use only. Not for therapeutic or diagnostic purposes.