제품 > 항체 > 다중클론항체(pAb)

RAB31 Rabbit pAb (A3667)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using RAB31 antibody (A3667) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunofluorescence - RAB31 Rabbit pAb (A3667)

Immunofluorescence analysis of A549 cells using RAB31 antibody (A3667). Blue: DAPI for nuclear staining.

Overview

Product name	RAB31 Rabbit pAb
Catalog No.	A3667
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables GDP binding activity and GTP binding activity. Involved in several processes, including Golgi to plasma membrane protein transport; cellular response to insulin stimulus; and receptor internalization. Located in early endosome; phagocytic vesicle; and trans-Golgi network membrane. Biomarker of severe acute respiratory syndrome.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-195 of human RAB31 (NP_006859.2).
Sequence	MMAIRELKVCLLGDTGVGKSSIVCRFVQDHFDHNISPTIGASFMTKTVPCGNELHKFLIWDTAGQERFHSLAPMYYRGSAAAVIVYDITKQDSFYTLKKWVKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQIPPLDPHENGNNGTIKVEKPTMQASRRCC
Gene ID
Swiss Prot
Synonyms	Rab22B
Calculated MW	22kDa
Observed MW	22kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:200 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	HL-60, Mouse lung, Rat brain, Rat lung
Cellular location	Cytoplasmic side, Cytoplasmic vesicle, Early endosome, Golgi apparatus, Lipid-anchor, phagosome, phagosome membrane, trans-Golgi network, trans-Golgi network membrane