제품 > 항체 > 다중클론항체(pAb)

RAB35 Rabbit pAb (A8030)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using RAB35 Rabbit pAb (A8030) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Western blot analysis of lysates from HeLa cells, using RAB35 Rabbit pAb (A8030) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - RAB35 Rabbit pAb (A8030)

Immunohistochemistry analysis of paraffin-embedded Rat heart using RAB35 Rabbit pAb (A8030) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - RAB35 Rabbit pAb (A8030)

Immunofluorescence analysis of PC-12 cells using RAB35 Rabbit pAb (A8030) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	RAB35 Rabbit pAb
Catalog No.	A8030
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables GTPase activity; guanyl ribonucleotide binding activity; and phosphatidylinositol-4, 5-bisphosphate binding activity. Involved in several processes, including endosomal transport; plasma membrane to endosome transport; and protein localization to endosome. Located in several cellular components, including clathrin-coated endocytic vesicle; clathrin-coated pit; and intercellular bridge.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 100-201 of human RAB35 (NP_006852.1).
Sequence	KRWLHEINQNCDDVCRILVGNKNDDPERKVVETEDAYKFAGQMGIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTKNSKRKKRCC
Gene ID
Swiss Prot
Synonyms	RAY; H-ray; RAB1C; RAB35
Calculated MW	23kDa
Observed MW	23kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	HeLa, Mouse brain, Rat brain
Cellular location	Cell membrane, Cytoplasmic side, Cytoplasmic vesicle, Endosome, Lipid-anchor, Melanosome, Membrane, clathrin-coated pit, clathrin-coated vesicle
Customer validation	WB(Rattus norvegicus, Homo sapiens)