제품 > 항체 > 단일클론항체(mAb)

RALBP1 Rabbit mAb (A9701)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Immunohistochemistry analysis of RALBP1 in paraffin-embedded rat colon tissue using RALBP1 Rabbit mAb (A9701) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of RALBP1 in paraffin-embedded mouse brain tissue using RALBP1 Rabbit mAb (A9701) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of RALBP1 in paraffin-embedded human colon carcinoma tissue using RALBP1 Rabbit mAb (A9701) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of RALBP1 in paraffin-embedded mouse testis tissue using RALBP1 Rabbit mAb (A9701) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - RALBP1 Rabbit mAb (A9701)

Immunofluorescence analysis of U-2 OS cells using RALBP1 Rabbit mAb (A9701) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	RALBP1 Rabbit mAb
Catalog No.	A9701
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1707

Background

RALBP1 plays a role in receptor-mediated endocytosis and is a downstream effector of the small GTP-binding protein RAL (see RALA; MIM 179550). Small G proteins, such as RAL, have GDP-bound inactive and GTP-bound active forms, which shift from the inactive to the active state through the action of RALGDS (MIM 601619), which in turn is activated by RAS (see HRAS; MIM 190020) (summary by Feig, 2003 [PubMed 12888294]).

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 200-300 of human RALBP1 (Q15311).
Sequence	RTMMYDGIRLPAVFRECIDYVEKYGMKCEGIYRVSGIKSKVDELKAAYDREESTNLEDYEPNTVASLLKQYLRDLPENLLTKELMPRFEEACGRTTETEKV
Gene ID
Swiss Prot
Synonyms	RIP1; RLIP1; RLIP76; RALBP1
Calculated MW	76kDa
Observed MW

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples
Cellular location	Membrane, Peripheral membrane protein