제품 > 항체 > 단일클론항체(mAb)

RAP1A + RAP1B Rabbit mAb (A9725)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using RAP1A + RAP1B Rabbit mAb (A9725) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunofluorescence - RAP1A + RAP1B Rabbit mAb (A9725)

Immunofluorescence analysis of C6 cells using RAP1A + RAP1B Rabbit mAb (A9725) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of NIH-3T3 cells using RAP1A + RAP1B Rabbit mAb (A9725) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of U-2 OS cells using RAP1A + RAP1B Rabbit mAb (A9725) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	RAP1A + RAP1B Rabbit mAb
Catalog No.	A9725
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1719

Background

This gene encodes a member of the RAS-like small GTP-binding protein superfamily. Members of this family regulate multiple cellular processes including cell adhesion and growth and differentiation. This protein localizes to cellular membranes and has been shown to regulate integrin-mediated cell signaling. This protein also plays a role in regulating outside-in signaling in platelets. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 3, 5, 6 and 9. [provided by RefSeq, Oct 2011]

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 70-150 of human RAP1A + RAP1B (P61224).
Sequence	LYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNNCAFLESSAKS
Gene ID
Swiss Prot
Synonyms	K-REV; RAL1B
Calculated MW	21kDa
Observed MW	21kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	HeLa, NIH/3T3, C6, U-251MG, HUVEC, Rat lung, Rat spleen
Cellular location	Cell-cell junction, Cytosol, Extracellular exosome, Glutamatergic synapse, Lipid droplet, Plasma membrane