Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | RBM19 Rabbit pAb |
---|---|
Catalog No. | A17600 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 759-960 of human RBM19 (NP_057280.2). |
---|---|
Sequence | CSISKKKNKAGVLLSMGFGFVEYRKPEQAQKALKQLQGHVVDGHKLEVRISERATKPAVTLARKKQVPRKQTTSKILVRNIPFQAHSREIRELFSTFGELKTVRLPKKMTGTGTHRGFGFVDFLTKQDAKRAFNALCHSTHLYGRRLVLEWADSEVTLQALRRKTAAHFHEPPKKKRSVVLDEILEQLEGSDSDSEEQTLQL |
Gene ID | |
Swiss Prot | |
Synonyms | Mrd1; RBM19 |
Calculated MW | 107kDa |
Observed MW | 107kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Raji |
Cellular location | cytoplasm, nuclear speck, nucleolus, nucleoplasm |
Customer validation | WB(Homo sapiens) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A17600? Please let us know so that we can cite the reference in this datasheet.