제품 > 항체 > 다중클론항체(pAb)

RELA Rabbit pAb (A22676)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates, using RELA Rabbit pAb (A22676) at 1:700 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.

ABclonal:Immunofluorescence - RELA Rabbit pAb (A22676)

Immunofluorescence analysis of HeLa cells using RELA Rabbit pAb (A22676) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of MCF7 cells using RELA Rabbit pAb (A22676) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of NIH/3T3 cells using RELA Rabbit pAb (A22676) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	RELA Rabbit pAb
Catalog No.	A22676
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables several functions, including DNA-binding transcription factor activity, RNA polymerase II-specific; actinin binding activity; and ankyrin repeat binding activity. Involved in several processes, including negative regulation of protein sumoylation; postsynapse to nucleus signaling pathway; and regulation of transcription, DNA-templated. Acts upstream of or within several processes, including cellular response to hepatocyte growth factor stimulus; cellular response to lipopolysaccharide; and positive regulation of interleukin-12 production. Located in several cellular components, including chromatin; cytosol; and glutamatergic synapse. Is expressed in several structures, including alimentary system; early conceptus; genitourinary system; musculature; and skin. Human ortholog(s) of this gene implicated in ductal carcinoma in situ; lung non-small cell carcinoma; lymphoma; and renal cell carcinoma. Orthologous to human RELA (RELA proto-oncogene, NF-kB subunit).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 400-500 of mouse RELA. (NP_033071.1).
Sequence	PLAQPPAPAPVLTPGPPQSLSAPVPKSTQAGEGTLSEALLHLQFDADEDLGALLGNSTDPGVFTDLASVDNSEFQQLLNQGVSMSHSTAEPMLMEYPEAIT
Gene ID
Swiss Prot
Synonyms	p65; p65 NFkB; p65 NF-kappa B; RELA
Calculated MW	60kDa
Observed MW	65kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	HeLa, Mouse liver
Cellular location	cytoplasm, cytosol, glutamatergic synapse, nucleus
Customer validation	IHC(Mus musculus) WB(Mus musculus)