제품 > 항체 > 단일클론항체(mAb)

REST/NRSF Rabbit mAb (A2415)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using REST/NRSF Rabbit mAb (A2415) at 1：1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Western blot analysis of lysates from Rat brain, using REST/NRSF Rabbit mAb (A2415) at 1：1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunoprecipitation - REST/NRSF Rabbit mAb (A2415)

Immunoprecipitation analysis of 300 μg extracts of U-87MG cells using 3 μg REST/NRSF antibody (A2415). Western blot was performed from the immunoprecipitate using REST/NRSF antibody (A2415) at a dilution of 1:1000.

Overview

Product name	REST/NRSF Rabbit mAb
Catalog No.	A2415
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0755

Background

This gene was initially identified as a transcriptional repressor that represses neuronal genes in non-neuronal tissues. However, depending on the cellular context, this gene can act as either an oncogene or a tumor suppressor. The encoded protein is a member of the Kruppel-type zinc finger transcription factor family. It represses transcription by binding a DNA sequence element called the neuron-restrictive silencer element. The protein is also found in undifferentiated neuronal progenitor cells and it is thought that this repressor may act as a master negative regulator of neurogenesis. Alternatively spliced transcript variants have been described.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 100-200 of human REST/NRSF (Q13127).
Sequence	KGEPHGLENMELRSLELSVVEPQPVFEASGAPDIYSSNKDLPPETPGAEDKGKSSKTKPFRCKPCQYEAESEEQFVHHIRVHSAKKFFVEESAEKQAKARE
Gene ID
Swiss Prot
Synonyms	WT6; XBR; HGF5; NRSF; DFNA27; GINGF5; REST/NRSF
Calculated MW	122kDa
Observed MW	170kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:6000 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunoprecipitation
Positive samples	HeLa, U-87MG, Mouse brain, Rat brain
Cellular location	Nucleus.