제품 > 항체 > 다중클론항체(pAb)

REXO2 Rabbit pAb (A15808)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using REXO2 Rabbit pAb (A15808) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

ABclonal:Immunofluorescence - REXO2 Rabbit pAb (A15808)

Immunofluorescence analysis of L929 cells using REXO2 Rabbit pAb (A15808) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of U-2 OS cells using REXO2 Rabbit pAb (A15808) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	REXO2 Rabbit pAb
Catalog No.	A15808
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a 3'-to-5' exonuclease specific for small (primarily 5 nucleotides or less in length) single-stranded RNA and DNA oligomers. This protein may have a role in DNA repair, replication, and recombination, and in RNA processing and degradation. It may also be involved in resistance of human cells to UV-C-induced cell death through its role in the DNA repair process.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 26-237 of human REXO2 (NP_056338.2).
Sequence	VREGGAAMAAGESMAQRMVWVDLEMTGLDIEKDQIIEMACLITDSDLNILAEGPNLIIKQPDELLDSMSDWCKEHHGKSGLTKAVKESTITLQQAEYEFLSFVRQQTPPGLCPLAGNSVHEDKKFLDKYMPQFMKHLHYRIIDVSTVKELCRRWYPEEYEFAPKKAASHRALDDISESIKELQFYRNNIFKKKIDEKKRKIIENGENEKTVS
Gene ID
Swiss Prot
Synonyms	RFN; SFN; REX2; CGI-114; REXO2
Calculated MW	27kDa
Observed MW	27kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:100
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	293T, U-87MG, LO2, HT-29
Cellular location	Cytoplasm, Mitochondrion intermembrane space, Mitochondrion matrix, Nucleus