제품 > 항체 > 다중클론항체(pAb)

RFC4 Rabbit pAb (A5485)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Rat

Western blot analysis of various lysates using RFC4 Rabbit pAb (A5485) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunofluorescence - RFC4 Rabbit pAb (A5485)

Immunofluorescence analysis of U2OS cells using RFC4 Rabbit pAb (A5485). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - RFC4 Rabbit pAb (A5485)

Immunoprecipitation analysis of 200 μg extracts of K562 cells using 1 μg RFC4 antibody (A5485). Western blot was performed from the immunoprecipitate using RFC4 antibody (A5485) at a dilution of 1:1000.

Overview

Product name	RFC4 Rabbit pAb
Catalog No.	A5485
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The elongation of primed DNA templates by DNA polymerase delta and DNA polymerase epsilon requires the accessory proteins proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also named activator 1, is a protein complex consisting of five distinct subunits of 140, 40, 38, 37, and 36 kD. This gene encodes the 37 kD subunit. This subunit forms a core complex with the 36 and 40 kDa subunits. The core complex possesses DNA-dependent ATPase activity, which was found to be stimulated by PCNA in an in vitro system. Alternatively spliced transcript variants encoding the same protein have been reported.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 204-363 of human RFC4 (NP_002907.1).
Sequence	DKIQQQRLLDIAKKENVKISDEGIAYLVKVSEGDLRKAITFLQSATRLTGGKEITEKVITDIAGVIPAEKIDGVFAACQSGSFDKLEAVVKDLIDEGHAATQLVNQLHDVVVENNLSDKQKSIITEKLAEVDKCLADGADEHLQLISLCATVMQQLSQNC
Gene ID
Swiss Prot
Synonyms	A1; RFC37; RFC4
Calculated MW	40kDa
Observed MW	40kDa

Applications

Reactivity	Human, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:100 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Immunoprecipitation
Positive samples	HeLa, SW480, 22Rv1, SW620, K-562, HepG2, MCF7
Cellular location	Nucleus
Customer validation	WB(Homo sapiens, Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

RFC4 Rabbit pAb images

Western blot - RFC4 Rabbit pAb (A5485)

Immunofluorescence - RFC4 Rabbit pAb (A5485)

Immunofluorescence analysis of U2OS cells using RFC4 Rabbit pAb (A5485). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence - RFC4 Rabbit pAb (A5485)

Immunofluorescence analysis of U2OS cells using RFC4 Rabbit pAb (A5485). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunoprecipitation - RFC4 Rabbit pAb (A5485)

* For research use only. Not for therapeutic or diagnostic purposes.