Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | RFWD2 Rabbit pAb |
---|---|
Catalog No. | A10463 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 582-731 of human RFWD2 (NP_071902.2). |
---|---|
Sequence | YYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGHINEKNFVGLASNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSAVCWRALPDGESNVLIAANSQGTIKVLELV |
Gene ID | |
Swiss Prot | |
Synonyms | FAP78; RFWD2; CFAP78; RNF200 |
Calculated MW | 80kDa |
Observed MW | 110kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | HepG2, MCF7 |
Cellular location | Cytoplasm, Nucleus speckle. |
Customer validation | IF(Homo sapiens, Rattus norvegicus) WB(Rattus norvegicus) IF(Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A10463? Please let us know so that we can cite the reference in this datasheet.