제품 > 항체 > 단일클론항체(mAb)

RHOA/RHOB/RHOC Rabbit mAb (A4855)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using RHOA/RHOB/RHOC Rabbit mAb (A4855) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - RHOA/RHOB/RHOC Rabbit mAb (A4855)

Immunohistochemistry analysis of paraffin-embedded Rat testis using RHOA/RHOB/RHOC Rabbit mAb (A4855) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - RHOA/RHOB/RHOC Rabbit mAb (A4855)

Immunofluorescence analysis of NIH-3T3 cells using RHOA/RHOB/RHOC Rabbit mAb (A4855) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	RHOA/RHOB/RHOC Rabbit mAb
Catalog No.	A4855
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0273

Background

This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. The protein encoded by this gene is prenylated at its C-terminus, and localizes to the cytoplasm and plasma membrane. It is thought to be important in cell locomotion. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008]

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-193 of human RHOA/RHOB/RHOC (P08134).
Sequence	MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL
Gene ID
Swiss Prot
Synonyms	ARH9; ARHC; H9; RHOH9; RHOA/RHOB/RHOC
Calculated MW	22kDa
Observed MW	22kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	HeLa, MCF7, NIH/3T3, SH-SY5Y, HUVEC, Mouse brain, Mouse kidney, Rat brain
Cellular location	cell cortex, cell projection, cytoplasmic vesicle, cytoskeleton, cytosol, extracellular exosome, neuron projection, nucleus, plasma membrane