제품 > 항체 > 단일클론항체(mAb)

RING1B/RNF2 Rabbit mAb (A3564)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using RING1B/RNF2 Rabbit mAb (A3564) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

ABclonal:Immunoprecipitation - RING1B/RNF2 Rabbit mAb (A3564)

Immunoprecipitation analysis of 300 μg extracts of U-937 cells using 3 μg RING1B/RNF2 antibody (A3564). Western blot was performed from the immunoprecipitate using RING1B/RNF2 antibody (A3564) at a dilution of 1:500.

Review

Overview

Product name	RING1B/RNF2 Rabbit mAb
Catalog No.	A3564
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0802

Background

Polycomb group (PcG) of proteins form the multiprotein complexes that are important for the transcription repression of various genes involved in development and cell proliferation. The protein encoded by this gene is one of the PcG proteins. It has been shown to interact with, and suppress the activity of, transcription factor CP2 (TFCP2/CP2). Studies of the mouse counterpart suggested the involvement of this gene in the specification of anterior-posterior axis, as well as in cell proliferation in early development. This protein was also found to interact with huntingtin interacting protein 2 (HIP2), an ubiquitin-conjugating enzyme, and possess ubiquitin ligase activity.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 100-200 of human RING1B/RNF2 (Q99496).
Sequence	LRPDPNFDALISKIYPSRDEYEAHQERVLARINKHNNQQALSHSIEEGLKIQAMNRLQRGKKQQIENGSGAEDNGDSSHCSNASTHSNQEAGPSNKRTKTS
Gene ID
Swiss Prot
Synonyms	BAP1; DING; BAP-1; HIPI3; RING2; LUSYAM; RING1B; RING1B/RNF2
Calculated MW	38kDa
Observed MW	38kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunoprecipitation
Positive samples	THP-1, U-937, Mouse testis, Mouse spleen, Rat testis
Cellular location	Chromosome, Nucleus
Customer validation	(E14)