제품 > 항체 > 다중클론항체(pAb)

RING1B/RNF2 Rabbit pAb (A5563)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from Jurkat cells, using RING1B/RNF2 Rabbit pAb (A5563) at 1:400 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - RING1B/RNF2 Rabbit pAb (A5563)

Immunohistochemistry analysis of paraffin-embedded Human liver cancer using RING1B/RNF2 Rabbit pAb (A5563) at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse kidney using RING1B/RNF2 Rabbit pAb (A5563) at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat kidney using RING1B/RNF2 Rabbit pAb (A5563) at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

ABclonal:Immunoprecipitation - RING1B/RNF2 Rabbit pAb (A5563)

Immunoprecipitation analysis of 200 μg extracts of 293T cells using 1 μg RING1B/RNF2 antibody (A5563). Western blot was performed from the immunoprecipitate using RING1B/RNF2 antibody (A5563) at a dilution of 1:1000.

ABclonal:Chromatin Immunoprecipitation - RING1B/RNF2 Rabbit pAb (A5563)

Chromatin immunoprecipitation analysis of extracts of HeLa cells, using RING1B/RNF2 antibody (A5563) and rabbit IgG. The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

Overview

Product name	RING1B/RNF2 Rabbit pAb
Catalog No.	A5563
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Polycomb group (PcG) of proteins form the multiprotein complexes that are important for the transcription repression of various genes involved in development and cell proliferation. The protein encoded by this gene is one of the PcG proteins. It has been shown to interact with, and suppress the activity of, transcription factor CP2 (TFCP2/CP2). Studies of the mouse counterpart suggested the involvement of this gene in the specification of anterior-posterior axis, as well as in cell proliferation in early development. This protein was also found to interact with huntingtin interacting protein 2 (HIP2), an ubiquitin-conjugating enzyme, and possess ubiquitin ligase activity.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-336 of human RING1B/RING1B/RNF2 (NP_009143.1).
Sequence	MSQAVQTNGTQPLSKTWELSLYELQRTPQEAITDGLEIVVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEYEAHQERVLARINKHNNQQALSHSIEEGLKIQAMNRLQRGKKQQIENGSGAEDNGDSSHCSNASTHSNQEAGPSNKRTKTSDDSGLELDNNNAAMAIDPVMDGASEIELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQMNLDTASEKQYTIYIATASGQFTVLNGSFSLELVSEKYWKVNKPMELYYAPTKEHK
Gene ID
Swiss Prot
Synonyms	BAP1; DING; BAP-1; HIPI3; RING2; LUSYAM; RING1B; RING1B/RNF2
Calculated MW	38kDa
Observed MW	41kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements. ChIP 5μg antibody for 10μg-15μg of Chromatin
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation
Positive samples	Jurkat
Cellular location	Chromosome, Nucleus.
Customer validation	WB(Homo sapiens, Mus musculus)