Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | RNASE2 Rabbit pAb |
---|---|
Catalog No. | A9949 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 28-161 of human RNASE2 (NP_002925.1). |
---|---|
Sequence | KPPQFTWAQWFETQHINMTSQQCTNAMQVINNYQRRCKNQNTFLLTTFANVVNVCGNPNMTCPSNKTRKNCHHSGSQVPLIHCNLTTPSPQNISNCRYAQTPANMFYIVACDNRDQRRDPPQYPVVPVHLDRII |
Gene ID | |
Swiss Prot | |
Synonyms | EDN; RAF3; RNS2; RNASE2 |
Calculated MW | 18kDa |
Observed MW | 26kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | K-562, HL-60, Mouse liver |
Cellular location | Cytoplasmic granule, Lysosome |
Customer validation | WB(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A9949? Please let us know so that we can cite the reference in this datasheet.