제품 > 항체 > 다중클론항체(pAb)

RND1 Rabbit pAb (A13705)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse, Rat

Western blot analysis of various lysates using RND1 Rabbit pAb (A13705) at 1:3000 dilution.

ABclonal:Immunofluorescence - RND1 Rabbit pAb (A13705)

Immunofluorescence analysis of L929 cells using RND1 Rabbit pAb (A13705) at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	RND1 Rabbit pAb
Catalog No.	A13705
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a protein that belongs to the Rho GTPase family. Members of this family regulate the organization of the actin cytoskeleton in response to extracellular growth factors. A similar protein in rat interacts with a microtubule regulator to control axon extension.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 133-232 of human RND1 (NP_055285.1).
Sequence	LSTLMELSHQKQAPISYEQGCAIAKQLGAEIYLEGSAFTSEKSIHSIFRTASMLCLNKPSPLPQKSPVRSLSKRLLHLPSRSELISSTFKKEKAKSCSIM
Gene ID
Swiss Prot
Synonyms	ARHS; RHO6; RHOS; RND1
Calculated MW	26kDa
Observed MW	26kDa

Applications

Reactivity	Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	Mouse brain, Mouse liver, Rat brain
Cellular location	Cell membrane, Cytoplasm, Cytoplasmic side, Lipid-anchor, cytoskeleton.