제품 > 항체 > 다중클론항체(pAb)

RNF144A Rabbit pAb (A17597)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Rat

Western blot analysis of various lysates using RNF144A Rabbit pAb (A17597) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Overview

Product name	RNF144A Rabbit pAb
Catalog No.	A17597
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a member of a family of RING finger domain-containing E3 ubiquitin ligases that also includes parkin and parc. The expression of this gene is induced by DNA damage. The encoded protein interacts with the cytoplasmic DNA-dependent protein kinase, catalytic subunit (DNA-PKcs) and promotes its degradation through ubiquitination. The orthologous mouse protein has been shown to interact with a ubiquitin-conjugating enzyme involved in embryonic development.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 52-179 of human RNF144A (NP_055561.2).
Sequence	ELLIKEGLETAISCPDAACPKQGHLQENEIECMVAAEIMQRYKKLQFEREVLFDPCRTWCPASTCQAVCQLQDVGLQTPQPVQCKACRMEFCSTCKASWHPGQGCPETMPITFLPGETSAAFKMEEDD
Gene ID
Swiss Prot
Synonyms	UIP4; hUIP4; RNF144; UBCE7IP4; RNF144A
Calculated MW	33kDa
Observed MW	38kDa

Applications

Reactivity	Human, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	A-431, Rat brain
Cellular location	cytoplasm, Golgi apparatus, plasma membrane