제품 > 항체 > 다중클론항체(pAb)

RNH1 Rabbit pAb (A4079)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using RNH1 antibody (A4079) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunofluorescence - RNH1 Rabbit pAb (A4079)

Immunofluorescence analysis of C6 cells using RNH1 Rabbit pAb (A4079) at dilution of 100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of L929 cells using RNH1 Rabbit pAb (A4079) at dilution of 100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of U-2 OS cells using RNH1 Rabbit pAb (A4079) at dilution of 100 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	RNH1 Rabbit pAb
Catalog No.	A4079
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Placental ribonuclease inhibitor (PRI) is a member of a family of proteinaceous cytoplasmic RNase inhibitors that occur in many tissues and bind to both intracellular and extracellular RNases (summarized by Lee et al., 1988 [PubMed 3219362]). In addition to control of intracellular RNases, the inhibitor may have a role in the regulation of angiogenin (MIM 105850). Ribonuclease inhibitor, of 50, 000 Da, binds to ribonucleases and holds them in a latent form. Since neutral and alkaline ribonucleases probably play a critical role in the turnover of RNA in eukaryotic cells, RNH may be essential for control of mRNA turnover; the interaction of eukaryotic cells with ribonuclease may be reversible in vivo.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 202-461 of human RNH1 (NP_002930.2).
Sequence	EALKLESCGVTSDNCRDLCGIVASKASLRELALGSNKLGDVGMAELCPGLLHPSSRLRTLWIWECGITAKGCGDLCRVLRAKESLKELSLAGNELGDEGARLLCETLLEPGCQLESLWVKSCSFTAACCSHFSSVLAQNRFLLELQISNNRLEDAGVRELCQGLGQPGSVLRVLWLADCDVSDSSCSSLAATLLANHSLRELDLSNNCLGDAGILQLVESVRQPGCLLEQLVLYDIYWSEEMEDRLQALEKDKPSLRVIS
Gene ID
Swiss Prot
Synonyms	RAI; RNH
Calculated MW	50kDa
Observed MW	43kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	Raji, U-87MG, HT-29, HeLa, Mouse liver, Mouse kidney, Mouse lung, Rat brain, Rat lung
Cellular location	Cytoplasm
Customer validation	WB(Mus musculus)