제품 > 항체 > 단일클론항체(mAb)

ROCK2 Rabbit mAb (A2395)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using ROCK2 Rabbit mAb (A2395) at 1：1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - ROCK2 Rabbit mAb (A2395)

Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using ROCK2 Rabbit mAb (A2395) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse intestin tissue using ROCK2 Rabbit mAb (A2395) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Overview

Product name	ROCK2 Rabbit mAb
Catalog No.	A2395
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0744

Background

The protein encoded by this gene is a serine/threonine kinase that regulates cytokinesis, smooth muscle contraction, the formation of actin stress fibers and focal adhesions, and the activation of the c-fos serum response element. This protein, which is an isozyme of ROCK1 is a target for the small GTPase Rho.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1289-1388 of human ROCK2 (O75116).
Sequence	PALECRRCHIKCHKDHMDKKEEIIAPCKVYYDISTAKNLLLLANSTEEQQKWVSRLVKKIPKKPPAPDPFARSSPRTSMKIQQNQSIRRPSRQLAPNKPS
Gene ID
Swiss Prot
Synonyms	ROCK-II; ROCK2
Calculated MW	161kDa
Observed MW	161kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 IHC-P 1:200 - 1:800 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	HeLa, U-87MG, Mouse lung, Mouse brain, Rat brain
Cellular location	Cell membrane, Cytoplasm, Nucleus, Peripheral membrane protein, centrosome, cytoskeleton, microtubule organizing center.
Customer validation	WB(Homo sapiens, Rattus norvegicus, Mus musculus, Sus scrofa) IHC(Homo sapiens)