Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse, Rat
Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IF staining protocol.Immunofluorescence analysis of mouse eye cells using RPGRIP1 Rabbit pAb (A24517) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.
| Product name | RPGRIP1 Rabbit pAb |
|---|---|
| Catalog No. | A24517 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1091-1286 of human RPGRIP1 (NP_065099.3). |
|---|---|
| Sequence | SEAQTTDSDDVIVPPMSQKYPKADSEKMCIEIVSLAFYPEAEVMSDENIKQVYVEYKFYDLPLSETETPVSLRKPRAGEEIHFHFSKVIDLDPQEQQGRRRFLFDMLNGQDPDQGHLKFTVVSDPLDEEKKECEEVGYAYLQLWQILESGRDILEQELDIVSPEDLATPIGRLKVSLQAAAVLHAIYKEMTEDLFS |
| Gene ID | |
| Swiss Prot | |
| Synonyms | RPGRIP1; CORD13; LCA6; RGI1; RGRIP; RPGRIP; RPGRIP1d; retinitis pigmentosa GTPase regulator interacting protein 1 |
| Calculated MW | 66kDa/70kDa/74kDa/76kDa/103kDa/146kDa |
| Observed MW | Refer to figures |
| Reactivity | Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
| Key application | Immunofluorescence |
| Positive samples | |
| Cellular location | Cell projection, cilium |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
