Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | RPL36AL Rabbit pAb |
---|---|
Catalog No. | A14366 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-106 of human RPL36AL (NP_000992.1). |
---|---|
Sequence | MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQGRRRYDRKQSGYGGQTKPIFRKKAKTTKKIVLRLECVEPNCRSKRMLAIKRCKHFELGGDKKRKGQVIQF |
Gene ID | |
Swiss Prot | |
Synonyms | RPL36A; RPL36AP42; RPL36A_18_1363; RPL36AL |
Calculated MW | 12kDa |
Observed MW | 16kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | 293T, A-549, HeLa, Jurkat, Mouse kidney, Mouse lung |
Cellular location | Cytoplasm |
Customer validation | WB(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A14366? Please let us know so that we can cite the reference in this datasheet.