제품 > 항체 > 다중클론항체(pAb)

RPL6 Rabbit pAb (A15094)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using RPL6 Rabbit pAb (A15094) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Overview

Product name	RPL6 Rabbit pAb
Catalog No.	A15094
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a protein component of the 60S ribosomal subunit. This protein can bind specifically to domain C of the tax-responsive enhancer element of human T-cell leukemia virus type 1, and may participate in tax-mediated transactivation of transcription. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed throughout the genome. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 188-288 of human RPL6 (NP_000961.2).
Sequence	RTHQKFVIATSTKIDISNVKIPKHLTDAYFKKKKLRKPRHQEGEIFDTEKEKYEITEQRKIDQKAVDSQILPKIKAIPQLQGYLRSVFALTNGIYPHKLVF
Gene ID
Swiss Prot
Synonyms	L6; eL6; TXREB1; SHUJUN-2; TAXREB107; RPL6
Calculated MW	33kDa
Observed MW	38kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	U-251MG, LO2, A549, HeLa, mouse liver, rat lung
Cellular location	cytoplasm, cytoplasmic ribonucleoprotein granule, cytosol, cytosolic ribosome, nucleus, postsynaptic density, rough endoplasmic reticulum
Customer validation	WB(Mus musculus, Homo sapiens)