제품 > 항체 > 다중클론항체(pAb)

RRAGA Rabbit pAb (A7771)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using RRAGA antibody (A7771) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunofluorescence - RRAGA Rabbit pAb (A7771)

Immunofluorescence analysis of C6 cells using RRAGA Rabbit pAb (A7771) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	RRAGA Rabbit pAb
Catalog No.	A7771
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables several functions, including GTP binding activity; protein dimerization activity; and ubiquitin protein ligase binding activity. Involved in several processes, including cellular response to amino acid starvation; negative regulation of autophagy; and positive regulation of TORC1 signaling. Located in lysosome and nucleus. Colocalizes with GATOR1 complex.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 213-313 of human RRAGA (NP_006561.1).
Sequence	VISHYQCKEQRDVHRFEKISNIIKQFKLSCSKLAASFQSMEVRNSNFAAFIDIFTSNTYVMVVMSDPSIPSAATLINIRNARKHFEKLERVDGPKHSLLMR
Gene ID
Swiss Prot
Synonyms	FIP1; RAGA; FIP-1
Calculated MW	37kDa
Observed MW	33kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	293T, HepG2, Mouse brain, Mouse kidney, Rat brain
Cellular location	Cytoplasm, Lysosome, Nucleus
Customer validation	WB(Homo sapiens,Mus musculus)