제품 > 항체 > 다중클론항체(pAb)

RRM1 Rabbit pAb (A13348)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using RRM1 Rabbit pAb (A13348) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.

ABclonal:Immunofluorescence - RRM1 Rabbit pAb (A13348)

Immunofluorescence analysis of HeLa cells using RRM1 Rabbit pAb (A13348) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - RRM1 Rabbit pAb (A13348)

Immunoprecipitation analysis of 200 μg extracts of HeLa cells using 1 μg RRM1 antibody (A13348). Western blot was performed from the immunoprecipitate using RRM1 antibody (A13348) at a dilution of 1:500.

Overview

Product name	RRM1 Rabbit pAb
Catalog No.	A13348
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes the large and catalytic subunit of ribonucleotide reductase, an enzyme essential for the conversion of ribonucleotides into deoxyribonucleotides. A pool of available deoxyribonucleotides is important for DNA replication during S phase of the cell cycle as well as multiple DNA repair processes. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 593-792 of human RRM1 (NP_001024.1).
Sequence	IRNSLLIAPMPTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPHLLKDLTERGLWHEEMKNQIIACNGSIQSIPEIPDDLKQLYKTVWEISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGKLTSMHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEKLKDKEKVSKEEEEKERNTAAMVCSLENRDECLMCGS
Gene ID
Swiss Prot
Synonyms	R1; RR1; RIR1; RRM1
Calculated MW	90kDa
Observed MW	95kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Immunoprecipitation
Positive samples	HeLa, SW480, 22Rv1, U-251MG, Mouse thymus, Mouse testis, Mouse spleen
Cellular location	Cytoplasm