제품 > 항체 > 단일클론항체(mAb)

RRM2 Rabbit mAb (A3424)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using RRM2 Rabbit mAb (A3424) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Review

Overview

Product name	RRM2 Rabbit mAb
Catalog No.	A3424
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0775

Background

This gene encodes one of two non-identical subunits for ribonucleotide reductase. This reductase catalyzes the formation of deoxyribonucleotides from ribonucleotides. Synthesis of the encoded protein (M2) is regulated in a cell-cycle dependent fashion. Transcription from this gene can initiate from alternative promoters, which results in two isoforms that differ in the lengths of their N-termini. Related pseudogenes have been identified on chromosomes 1 and X.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 10-117 of human RRM2 (P31350).
Sequence	PITDPQQLQLSPLKGLSLVDKENTPPALSGTRVLASKTARRIFQEPTEPKTKAAAPGVEDEPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWE
Gene ID
Swiss Prot
Synonyms	R2; RR2; RR2M; C2orf48
Calculated MW	45kDa
Observed MW	45kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HeLa, A-375, Mouse liver, Rat liver
Cellular location	Cytoplasm
Customer validation	(293T、HeLa 、RPMI-8226、MLOT-4 、 PC-3、Jurkat、T-47D , 293T,Hela,RPMI-8226,Molt-4,HL-60,PC-3,JURKAT,T-47D,A549) WB(Homo sapiens)