Review (2)Publication (4) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | RRM2 Rabbit mAb |
---|---|
Catalog No. | A3424 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0775 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 10-117 of human RRM2 (P31350). |
---|---|
Sequence | PITDPQQLQLSPLKGLSLVDKENTPPALSGTRVLASKTARRIFQEPTEPKTKAAAPGVEDEPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWE |
Gene ID | |
Swiss Prot | |
Synonyms | R2; RR2; RR2M; C2orf48 |
Calculated MW | 45kDa |
Observed MW | 45kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | HeLa, A-375, Mouse liver, Rat liver |
Cellular location | Cytoplasm |
Customer validation | (293T、HeLa 、RPMI-8226、MLOT-4 、 PC-3、Jurkat、T-47D , 293T,Hela,RPMI-8226,Molt-4,HL-60,PC-3,JURKAT,T-47D,A549) WB(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A3424? Please let us know so that we can cite the reference in this datasheet.