Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | RSAD2 Rabbit pAb |
---|---|
Catalog No. | A8271 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 118-361 of human RSAD2 (NP_542388.2). |
---|---|
Sequence | EKINFSGGEPFLQDRGEYLGKLVRFCKVELRLPSVSIVSNGSLIRERWFQNYGEYLDILAISCDSFDEEVNVLIGRGQGKKNHVENLQKLRRWCRDYRVAFKINSVINRFNVEEDMTEQIKALNPVRWKVFQCLLIEGENCGEDALREAERFVIGDEEFERFLERHKEVSCLVPESNQKMKDSYLILDEYMRFLNCRKGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKYIWSKADLKLDW |
Gene ID | |
Swiss Prot | |
Synonyms | SAND; cig5; vig1; cig33; RSAD2 |
Calculated MW | 42kDa |
Observed MW | 46kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | PC-3, Mouse spleen, Rat lung, Rat spleen, Rat kidney |
Cellular location | Cytoplasmic side, Endoplasmic reticulum, Endoplasmic reticulum membrane, Golgi apparatus, Lipid droplet, Mitochondrion, Mitochondrion inner membrane, Mitochondrion outer membrane, Peripheral membrane protein |
Customer validation | IF(Mus musculus) WB(Mus musculus, Homo sapiens) RT-qPCR(Sus scrofa) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A8271? Please let us know so that we can cite the reference in this datasheet.