제품 > 항체 > 다중클론항체(pAb)

RUNX1 Rabbit pAb (A2055)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from Molt-4 cells, using RUNX1 Rabbit pAb (A2055) at 1:700 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.

ABclonal:Immunohistochemistry - RUNX1 Rabbit pAb (A2055)

Immunohistochemistry analysis of paraffin-embedded rat kidney using RUNX1 Rabbit pAb (A2055) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human esophageal cancer using RUNX1 Rabbit pAb (A2055) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded mouse brain using RUNX1 Rabbit pAb (A2055) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - RUNX1 Rabbit pAb (A2055)

Immunofluorescence analysis of A549 cells using RUNX1 Rabbit pAb (A2055). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	RUNX1 Rabbit pAb
Catalog No.	A2055
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Core binding factor (CBF) is a heterodimeric transcription factor that binds to the core element of many enhancers and promoters. The protein encoded by this gene represents the alpha subunit of CBF and is thought to be involved in the development of normal hematopoiesis. Chromosomal translocations involving this gene are well-documented and have been associated with several types of leukemia. Three transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 171-260 of human RUNX1 (NP_001001890.1).
Sequence	DGPREPRRHRQKLDDQTKPGSLSFSERLSELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFNPQPQSQMQDTRQIQPSPPWSYDQSYQY
Gene ID
Swiss Prot
Synonyms	AML1; CBFA2; EVI-1; AMLCR1; PEBP2aB; CBF2alpha; AML1-EVI-1; PEBP2alpha; RUNX1
Calculated MW	49kDa
Observed MW	55kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:700 IHC-P 1:50 - 1:100 IF/ICC 1:50 - 1:100
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	Molt-4
Cellular location	Nucleus
Customer validation	WB(Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

RUNX1 Rabbit pAb images

Western blot - RUNX1 Rabbit pAb (A2055)

Immunohistochemistry - RUNX1 Rabbit pAb (A2055)

Immunofluorescence - RUNX1 Rabbit pAb (A2055)

Immunofluorescence analysis of A549 cells using RUNX1 Rabbit pAb (A2055). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

* For research use only. Not for therapeutic or diagnostic purposes.