Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | RUVBL1/TIP49A/PONTIN Rabbit mAb |
---|---|
Catalog No. | A5180 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC1247 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 350-456 of human RUVBL1/TIP49A/PONTIN (Q9Y265). |
---|---|
Sequence | IPLDLLDRVMIIRTMLYTPQEMKQIIKIRAQTEGINISEEALNHLGEIGTKTTLRYSVQLLTPANLLAKINGKDSIEKEHVEEISELFYDAKSSAKILADQQDKYMK |
Gene ID | |
Swiss Prot | |
Synonyms | RVB1; TIH1; ECP54; TIP49; ECP-54; INO80H; NMP238; PONTIN; TIP49A; NMP 238; Pontin52; RUVBL1/TIP49A/PONTIN |
Calculated MW | 50kDa |
Observed MW | 51kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | U-2 OS, A-431, HT-1080, Mouse brain, Mouse spleen, Rat brain |
Cellular location | Cytoplasm, Membrane, Nucleus, Nucleus matrix, centrosome, cytoskeleton, microtubule organizing center, nucleoplasm. |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.