Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | RXFP1 Rabbit pAb |
---|---|
Catalog No. | A7127 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 673-757 of human RXFP1 (NP_067647.2). |
---|---|
Sequence | NSALNPILYTLTTRPFKEMIHRFWYNYRQRKSMDSKGQKTYAPSFIWVEMWPLQEMPPELMKPDLFTYPCEMSLISQSTRLNSYS |
Gene ID | |
Swiss Prot | |
Synonyms | LGR7; RXFPR1; RXFP1 |
Calculated MW | 87kDa |
Observed MW | 87kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | 293T, HeLa, Mouse brain, Rat brain, Rat testis |
Cellular location | Cell membrane, Multi-pass membrane protein |
* For research use only. Not for therapeutic or diagnostic purposes.