Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | RXFP2 Rabbit pAb |
---|---|
Catalog No. | A14440 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 80-180 of human RXFP2 (NP_570718.1). |
---|---|
Sequence | CGDTSGWATIFGTVHGNANSVALTQECFLKQYPQCCDCKETELECVNGDLKSVPMISNNVTLLSLKKNKIHSLPDKVFIKYTKLKKIFLQHNCIRHISRKA |
Gene ID | |
Swiss Prot | |
Synonyms | LGR8; GREAT; GPR106; INSL3R; LGR8.1; RXFPR2; RXFP2 |
Calculated MW | 86kDa |
Observed MW | 86kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | U-87MG, 293T, HeLa, K-562, Mouse brain, Mouse kidney, Mouse testis, Rat brain, Rat kidney |
Cellular location | Cell membrane, Multi-pass membrane protein |
* For research use only. Not for therapeutic or diagnostic purposes.