제품 > 항체 > 단일클론항체(mAb)

RanBP9 Rabbit mAb (A19238)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using RanBP9 Rabbit mAb (A19238) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - RanBP9 Rabbit mAb (A19238)

Immunohistochemistry analysis of paraffin-embedded rat testis using RanBP9 Rabbit mAb (A19238) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human brain using RanBP9 Rabbit mAb (A19238) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Overview

Product name	RanBP9 Rabbit mAb
Catalog No.	A19238
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2397

Background

This gene encodes a protein that binds RAN, a small GTP binding protein belonging to the RAS superfamily that is essential for the translocation of RNA and proteins through the nuclear pore complex. The protein encoded by this gene has also been shown to interact with several other proteins, including met proto-oncogene, homeodomain interacting protein kinase 2, androgen receptor, and cyclin-dependent kinase 11.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 100-200 of human RanBP9 (Q96S59).
Sequence	SGPPAPPGLAAGPGPAGGAPTPALVAGSSAAAPFPHGDSALNEQEKELQRRLKRLYPAVDEQETPLPRSWSPKDKFSYIGLSQNNLRVHYKGHGKTPKDAA
Gene ID
Swiss Prot
Synonyms	BPM-L; BPM90; RANBPM; RanBP7; RanBP9
Calculated MW	78kDa
Observed MW	80kDa/91kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	C2C12, RD, C6, Mouse testis, Rat testis
Cellular location	Cytoplasm, Nucleus, cytosol
Customer validation	WB(Homo sapiens)