Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates, using RbAp46/RBBP7 Rabbit mAb (A22274) at1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.
Immunohistochemistry analysis of RbAp46/RBBP7 in paraffin-embedded rat liver tissue using RbAp46/RBBP7 Rabbit mAb (A22274) at a dilution of 1:400 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of RbAp46/RBBP7 in paraffin-embedded mouse colon tissue using RbAp46/RBBP7 Rabbit mAb (A22274) at a dilution of 1:400 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of RbAp46/RBBP7 in paraffin-embedded mouse testis tissue using RbAp46/RBBP7 Rabbit mAb (A22274) at a dilution of 1:400 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of RbAp46/RBBP7 in paraffin-embedded rat colon tissue using RbAp46/RBBP7 Rabbit mAb (A22274) at a dilution of 1:400 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of RbAp46/RBBP7 in paraffin-embedded human small intestine tissue using RbAp46/RBBP7 Rabbit mAb (A22274) at a dilution of 1:400 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunofluorescence analysis of NIH/3T3 cells using RbAp46/RBBP7 Rabbit mAb (A22274) at dilution of 1:100(40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
| Product name | RbAp46/RBBP7 Rabbit mAb |
|---|---|
| Catalog No. | A22274 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC55384 |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-230 of human RbAp46/RBBP7 (NP_002884.1). |
|---|---|
| Sequence | MASKEMFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKINHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGPKEGKIVDAKAIFTGHSAVVE |
| Gene ID | |
| Swiss Prot | |
| Synonyms | RbAp46; RbAp46/RBBP7 |
| Calculated MW | 48kDa |
| Observed MW | 50kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence |
| Positive samples | 293F, HeLa, Mouse placenta, NIH/3T3 |
| Cellular location | Nucleus |
| Customer validation | WB(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A22274? Please let us know so that we can cite the reference in this datasheet.
