제품 > 항체 > 단일클론항체(mAb)

Rev-erb beta/NR1D2 Rabbit mAb (A22050)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse, Rat

Western blot analysis of various lysates, using Rev-erb beta/NR1D2 Rabbit mAb (A22050) at1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Overview

Product name	Rev-erb beta/NR1D2 Rabbit mAb
Catalog No.	A22050
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC54887

Background

This gene encodes a member of the nuclear hormone receptor family, specifically the NR1 subfamily of receptors. The encoded protein functions as a transcriptional repressor and may play a role in circadian rhythms and carbohydrate and lipid metabolism. Alternatively spliced transcript variants have been described.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 220-300 of human Rev-erb beta/NR1D2 (NP_005117.3).
Sequence	ALPAQEQLRPKPQLEQENIKSSSPPSSDFAKEEVIGMVTRAHKDTFMYNQEQQENSAESMQPQRGERIPKNMEQYNLNHDH
Gene ID
Swiss Prot
Synonyms	RVR; BD73; EAR-1R; REVERBB; REVERBbeta
Calculated MW	65kDa
Observed MW	70kDa

Applications

Reactivity	Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Mouse lung, Rat lung, Mouse skeletal muscle
Cellular location	cytoplasm, nucleoplasm, nucleus