Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | RhoB Rabbit mAb |
---|---|
Catalog No. | A22258 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC56483 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 70-150 of human RhoB (NP_004031.1). |
---|---|
Sequence | RPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVR |
Gene ID | |
Swiss Prot | |
Synonyms | ARH6; ARHB; RHOH6; MST081; MSTP081 |
Calculated MW | 22kDa |
Observed MW | 22kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | SK-BR-3, HeLa, Mouse brain, Mouse kidney, Rat brain, Rat lung |
Cellular location | Cell membrane, Cleavage furrow, Late endosome membrane, Lipid-anchor, Nucleus |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.