제품 > 항체 > 단일클론항체(mAb)

RhoGAP Rabbit mAb (A2330)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using RhoGAP Rabbit mAb (A2330) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

ABclonal:Immunoprecipitation - RhoGAP Rabbit mAb (A2330)

Immunoprecipitation analysis of 600 μg extracts of Mouse brain cells using 3 μg RhoGAP antibody (A2330). Western blot was performed from the immunoprecipitate using RhoGAP antibody (A2330) at a dilution of 1:500.

Overview

Product name	RhoGAP Rabbit mAb
Catalog No.	A2330
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1916

Background

Rho GTPase activating protein 5 negatively regulates RHO GTPases, a family which may mediate cytoskeleton changes by stimulating the hydrolysis of bound GTP. Two transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1150-1300 of human RhoGAP (Q13017).
Sequence	PSKYKYKSKTLFSKAKSYYRRTHSDASDDEAFTTSKTKRKGRHRGSEEDPLLSPVETWKGGIDNPAITSDQELDDKKMKKKTHKVKEDKKQKKKTKNFNPPTRRNWESNYFGMPLQDLVTAEKPIPLFVEKCVEFIEDTGLCTEGLYRVSG
Gene ID
Swiss Prot
Synonyms	GFI2; p190-B; RhoGAP5; p190BRhoGAP; RhoGAP
Calculated MW	172kDa
Observed MW	190kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IP 0.5μg-4μg antibody for 400μg-600μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunoprecipitation
Positive samples	HeLa, MCF7, C2C12, Mouse brain, Rat brain
Cellular location	Cytoplasm, Membrane, Peripheral membrane protein.