제품 > 항체 > 다중클론항체(pAb)

Rnf170 Rabbit pAb (A15196)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Western blot analysis of various lysates using Rnf170 Rabbit pAb (A15196) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Overview

Product name	Rnf170 Rabbit pAb
Catalog No.	A15196
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to enable metal ion binding activity and ubiquitin protein ligase activity. Predicted to be located in endoplasmic reticulum and membrane. Predicted to be integral component of membrane. Used to study hereditary ataxia. Human ortholog(s) of this gene implicated in autosomal dominant sensory ataxia 1. Orthologous to human RNF170 (ring finger protein 170).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of mouse Rnf170 (NP_084241.1).
Sequence	MQRYWRFQDNKIQDICFGVLGESWIQRPVMARYYSEGQSLQQDDSFIEGVSDQVLVAVVVSLALTATLLYALLRNVQQNIHPENQELVRVLREQFQTEQDVPAPARQQFYTEMYCPICLHQASFPVETNCGHLFCGSCIIAYWRYGSWLGAISCPICRQTVTLLLTVFGEDDQSQDVIRLRQDVNDYNRRFSGQPRSIME
Gene ID
Swiss Prot
Synonyms	6720407G21Rik; Rnf170
Calculated MW	16kDa/24kDa/28kDa/33kDa
Observed MW	28kDa

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Mouse pancreas, Mouse testis
Cellular location	Endoplasmic reticulum membrane, Multi-pass membrane protein