제품 > 항체 > 다중클론항체(pAb)

S100A8 Rabbit pAb (A20474)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse, Rat

Western blot analysis of various lysates using S100A8 Rabbit pAb (A20474) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunohistochemistry - S100A8 Rabbit pAb (A20474)

Immunohistochemistry analysis of paraffin-embedded mouse spleen using S100A8 Rabbit pAb (A20474) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded rat spleen using S100A8 Rabbit pAb (A20474) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Overview

Product name	S100A8 Rabbit pAb
Catalog No.	A20474
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to enable calcium ion binding activity and calcium-dependent protein binding activity. Acts upstream of or within astrocyte development and positive regulation of peptide secretion. Predicted to be located in cytosol and intermediate filament cytoskeleton. Predicted to be active in extracellular space. Is expressed in several structures, including bone marrow; extraembryonic component; female reproductive system; and liver. Human ortholog(s) of this gene implicated in myocarditis. Orthologous to human S100A8 (S100 calcium binding protein A8).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-89 of mouse S100A8 (NP_038678.1).
Sequence	MPSELEKALSNLIDVYHNYSNIQGNHHALYKNDFKKMVTTECPQFVQNINIENLFRELDINSDNAINFEEFLAMVIKVGVASHKDSHKE
Gene ID
Swiss Prot
Synonyms	p8; B8Ag; CFAg; Caga; MRP8; CP-10; 60B8Ag; S100A8
Calculated MW	10kDa
Observed MW	11kDa

Applications

Reactivity	Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	Mouse lung, Mouse spleen, Rat spleen
Cellular location	cytosol, extracellular space, intermediate filament cytoskeleton, plasma membrane