제품 > 항체 > 다중클론항체(pAb)

S100P Rabbit pAb (A14780)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates using S100P Rabbit pAb (A14780) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

ABclonal:Immunohistochemistry - S100P Rabbit pAb (A14780)

Immunohistochemistry analysis of paraffin-embedded Human placenta using S100P Rabbit pAb (A14780) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - S100P Rabbit pAb (A14780)

Immunofluorescence analysis of paraffin-embedded human placenta using S100P Rabbit pAb (A14780) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - S100P Rabbit pAb (A14780)

Immunoprecipitation analysis of 300 μg extracts of HT-29 cells using 3 μg S100P antibody (A14780). Western blot was performed from the immunoprecipitate using S100P antibody (A14780) at a dilution of 1:1000.

Overview

Product name	S100P Rabbit pAb
Catalog No.	A14780
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21; however, this gene is located at 4p16. This protein, in addition to binding Ca2+, also binds Zn2+ and Mg2+. This protein may play a role in the etiology of prostate cancer.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-95 of human S100P (NP_005971.1).
Sequence	MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK
Gene ID
Swiss Prot
Synonyms	MIG9; S100P
Calculated MW	10kDa
Observed MW	10kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:100 - 1:200 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation
Positive samples	HT-29, BxPC-3
Cellular location	Cell projection, Cytoplasm, Nucleus, microvillus membrane.
Customer validation	WB(Homo sapiens)