제품 > 항체 > 다중클론항체(pAb)

SAA3 Rabbit pAb (A11948)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using SAA3 Rabbit pAb (A11948) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5min.

Overview

Product name	SAA3 Rabbit pAb
Catalog No.	A11948
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables Toll-like receptor 4 binding activity and chemoattractant activity. Acts upstream of or within several processes, including I-kappaB phosphorylation; cellular response to interleukin-1; and response to stilbenoid. Located in extracellular space. Is expressed in cerebellum; ileum; liver; reproductive system; and thymus. Orthologous to several human genes including SAA2 (serum amyloid A2).

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 50-123 of mouse SAA3P (NP_035445.1).
Sequence	SDKYFHARGNYDAARRGPGGAWAAKVISDAREAVQKFTGHGAEDSRADQFANEWGRSGKDPNHFRPAGLPKRY
Gene ID
Swiss Prot
Synonyms	l7R3; Saa-3; SAA3
Calculated MW	13kDa
Observed MW	14kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Human serum, LO2, Mouse liver, Mouse thymus, Mouse lung, Rat liver
Cellular location
Customer validation	WB(Mus musculus)