제품 > 항체 > 단일클론항체(mAb)

SAMHD1 Rabbit mAb (A4607)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates using SAMHD1 Rabbit mAb (A4607) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

ABclonal:Immunohistochemistry - SAMHD1 Rabbit mAb (A4607)

Immunohistochemistry analysis of paraffin-embedded Human appendix using SAMHD1 Rabbit mAb (A4607) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Overview

Product name	SAMHD1 Rabbit mAb
Catalog No.	A4607
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1050

Background

This gene may play a role in regulation of the innate immune response. The encoded protein is upregulated in response to viral infection and may be involved in mediation of tumor necrosis factor-alpha proinflammatory responses. Mutations in this gene have been associated with Aicardi-Goutieres syndrome.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 527-626 of human SAMHD1 (NP_056289.2).
Sequence	NRAIRITKNQVSQLLPEKFAEQLIRVYCKKVDRKSLYAARQYFVQWCADRNFTKPQDGDVIAPLITPQKKEWNDSTSVQNPTRLREASKSRVQLFKDDPM
Gene ID
Swiss Prot
Synonyms	DCIP; CHBL2; HDDC1; MOP-5; SBBI88; hSAMHD1; SAMHD1
Calculated MW	72kDa
Observed MW	72kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	HepG2, Raji
Cellular location	Nucleoplasm, Nucleus, Plasma membrane, Tetraspanin-enriched microdomain